-
Specification:100ul/200ul/1ml Description:
Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF, GHRF) or somatocrinin, is a releasing hormone for growth hormone. It is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus.
GHRH first appears in the human hypothalamus between 18…
-
Specification:100ul/200ul/1ml Description:
Gastric inhibitory polypeptide (GIP), also known as the glucose-dependent insulinotropic peptide is a member of the secretin family of hormones.
GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins.
It has traditionally been called gastrointestinal…
-
Specification:100ul/200ul/1ml Description:
The green fluorescent protein (GFP) is a protein composed of 238 amino acids (26.9kDa), which exhibits bright green fluorescence when exposed to blue light.Although many other marine organisms have similar green fluorescent proteins, GFP traditionally refers to the protein first isolated from the…
-
Specification:100ul/200ul/1ml Description:
Glial fibrillary acidic protein (GFAP) is an intermediate filament (IF) protein that was thought to be specific for astrocytes in the central nervous system (CNS). Later, it was shown that GFAP is also expressed by other cell types in CNS, including ependymal cells.[citation needed] GFAP has also been…
-
Specification:100ul/200ul/1ml Description:
Glucagon-like peptide-1 (GLP-1) is derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. The biologically active forms of GLP-1 are: GLP-1-(7-37) and GLP-1-(7-36)NH2.
GLP-1 secretion by L cells…
-
Specification:100ul/200ul/1ml Description:
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by…
-
Specification:100ul/200ul/1mlDescription:
Gremlin (also known as Increased in High Glucose Protein 2, IHG-2, Down-regulated in Mos-transformed cells protein, Drm) functions as a bone morphogenetic protein (BMP) antagonist. It acts by binding to, and forming heterodimers with BMP-2, BMP-4, BMP-7, thus preventing them from interacting with their…
-
Specification:100ul/200ul/1mlDescription:
HNF-1α is a 631-aa atypical homeodomain-containing protein, which was identified first through its ability to bind to critical regulatory cis elements present in the 5′-flanking region of liver-specific genes such as those encoding albumin, fibrinogen, transthyretin (TTR), and α1-antitripsin . HNF-1α is…
Specification:100ul/200ul/1ml Description: Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF, GHRF) or somatocrinin, is a releasing hormone for growth hormone. It is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH first appears in the human hypothalamus between 18…
Specification:100ul/200ul/1ml Description: Gastric inhibitory polypeptide (GIP), also known as the glucose-dependent insulinotropic peptide is a member of the secretin family of hormones. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins. It has traditionally been called gastrointestinal…
Specification:100ul/200ul/1ml Description: The green fluorescent protein (GFP) is a protein composed of 238 amino acids (26.9kDa), which exhibits bright green fluorescence when exposed to blue light.Although many other marine organisms have similar green fluorescent proteins, GFP traditionally refers to the protein first isolated from the…
Specification:100ul/200ul/1ml Description: Glial fibrillary acidic protein (GFAP) is an intermediate filament (IF) protein that was thought to be specific for astrocytes in the central nervous system (CNS). Later, it was shown that GFAP is also expressed by other cell types in CNS, including ependymal cells.[citation needed] GFAP has also been…
Specification:100ul/200ul/1ml Description: Glucagon-like peptide-1 (GLP-1) is derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. The biologically active forms of GLP-1 are: GLP-1-(7-37) and GLP-1-(7-36)NH2. GLP-1 secretion by L cells…
Specification:100ul/200ul/1ml Description: Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by…
Specification:100ul/200ul/1mlDescription: Gremlin (also known as Increased in High Glucose Protein 2, IHG-2, Down-regulated in Mos-transformed cells protein, Drm) functions as a bone morphogenetic protein (BMP) antagonist. It acts by binding to, and forming heterodimers with BMP-2, BMP-4, BMP-7, thus preventing them from interacting with their…
Specification:100ul/200ul/1mlDescription: HNF-1α is a 631-aa atypical homeodomain-containing protein, which was identified first through its ability to bind to critical regulatory cis elements present in the 5′-flanking region of liver-specific genes such as those encoding albumin, fibrinogen, transthyretin (TTR), and α1-antitripsin . HNF-1α is…
